FGF21 monoclonal antibody (M01), clone 2F11
  • FGF21 monoclonal antibody (M01), clone 2F11

FGF21 monoclonal antibody (M01), clone 2F11

Ref: AB-H00026291-M01
FGF21 monoclonal antibody (M01), clone 2F11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant FGF21.
Información adicional
Size 100 ug
Gene Name FGF21
Gene Alias -
Gene Description fibroblast growth factor 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGF21 (AAH18404, 30 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26291
Clone Number 2F11
Iso type IgG1 Kappa

Enviar uma mensagem


FGF21 monoclonal antibody (M01), clone 2F11

FGF21 monoclonal antibody (M01), clone 2F11