TINF2 monoclonal antibody (M02), clone 3G11
  • TINF2 monoclonal antibody (M02), clone 3G11

TINF2 monoclonal antibody (M02), clone 3G11

Ref: AB-H00026277-M02
TINF2 monoclonal antibody (M02), clone 3G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TINF2.
Información adicional
Size 100 ug
Gene Name TINF2
Gene Alias TIN2|TIN2L
Gene Description TERF1 (TRF1)-interacting nuclear factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISNPESKEEHAIYTADLAMGTRAPSNGKYKGPYQTLGGRALKENPVDLPATEQKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TINF2 (NP_036593, 256 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26277
Clone Number 3G11
Iso type IgG2b Kappa

Enviar uma mensagem


TINF2 monoclonal antibody (M02), clone 3G11

TINF2 monoclonal antibody (M02), clone 3G11