TINF2 purified MaxPab mouse polyclonal antibody (B01P)
  • TINF2 purified MaxPab mouse polyclonal antibody (B01P)

TINF2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026277-B01P
TINF2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TINF2 protein.
Información adicional
Size 50 ug
Gene Name TINF2
Gene Alias TIN2|TIN2L
Gene Description TERF1 (TRF1)-interacting nuclear factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MATPLVAGPAALRFAAAASWQVVRGRCVEHFPRVLEFLRSLRAVAPGLVRYRHHERLCMGLKAKVVVELILQGRPWAQVLKALNHHFPESGPIVRDPKATKQDLRKILEAQETFYQQVKQLSEAPVDLASKLQELEQEYGEPFLAAMEKLLFEYLCQLEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRLALHNPLPKAKPGTHLPQGPSSRTHPEPLAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TINF2 (AAH05030.1, 1 a.a. ~ 451 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26277

Enviar uma mensagem


TINF2 purified MaxPab mouse polyclonal antibody (B01P)

TINF2 purified MaxPab mouse polyclonal antibody (B01P)