TINF2 polyclonal antibody (A01)
  • TINF2 polyclonal antibody (A01)

TINF2 polyclonal antibody (A01)

Ref: AB-H00026277-A01
TINF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TINF2.
Información adicional
Size 50 uL
Gene Name TINF2
Gene Alias TIN2|TIN2L
Gene Description TERF1 (TRF1)-interacting nuclear factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISNPESKEEHAIYTADLAMGTRAPSNGKYKGPYQTLGGRALKENPVDLPATEQKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TINF2 (NP_036593, 256 a.a. ~ 354 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26277

Enviar uma mensagem


TINF2 polyclonal antibody (A01)

TINF2 polyclonal antibody (A01)