FBXO4 MaxPab rabbit polyclonal antibody (D01)
  • FBXO4 MaxPab rabbit polyclonal antibody (D01)

FBXO4 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00026272-D01
FBXO4 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FBXO4 protein.
Información adicional
Size 100 uL
Gene Name FBXO4
Gene Alias DKFZp547N213|FBX4|FLJ10141
Gene Description F-box protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLTRLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVTDGAFFDYMAVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTTRKERDRAREEHTSAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXO4 (NP_036308.1, 1 a.a. ~ 387 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 26272

Enviar uma mensagem


FBXO4 MaxPab rabbit polyclonal antibody (D01)

FBXO4 MaxPab rabbit polyclonal antibody (D01)