FBXO5 polyclonal antibody (A01)
  • FBXO5 polyclonal antibody (A01)

FBXO5 polyclonal antibody (A01)

Ref: AB-H00026271-A01
FBXO5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXO5.
Información adicional
Size 50 uL
Gene Name FBXO5
Gene Alias EMI1|FBX5|Fbxo31
Gene Description F-box protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXO5 (NP_036309, 358 a.a. ~ 446 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26271

Enviar uma mensagem


FBXO5 polyclonal antibody (A01)

FBXO5 polyclonal antibody (A01)