FBXO8 polyclonal antibody (A01)
  • FBXO8 polyclonal antibody (A01)

FBXO8 polyclonal antibody (A01)

Ref: AB-H00026269-A01
FBXO8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXO8.
Información adicional
Size 50 uL
Gene Name FBXO8
Gene Alias DC10|FBS|FBX8
Gene Description F-box protein 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFINLEMLPPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXO8 (NP_036312, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26269

Enviar uma mensagem


FBXO8 polyclonal antibody (A01)

FBXO8 polyclonal antibody (A01)