FBXO24 monoclonal antibody (M01), clone 7F12 View larger

Mouse monoclonal antibody raised against a partial recombinant FBXO24.

AB-H00026261-M01

New product

FBXO24 monoclonal antibody (M01), clone 7F12

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name FBXO24
Gene Alias DKFZp434I1122|FBX24
Gene Description F-box protein 24
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXO24 (NP_277041, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26261
Clone Number 7F12
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant FBXO24.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant FBXO24.

Mouse monoclonal antibody raised against a partial recombinant FBXO24.