FBXW8 polyclonal antibody (A01)
  • FBXW8 polyclonal antibody (A01)

FBXW8 polyclonal antibody (A01)

Ref: AB-H00026259-A01
FBXW8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXW8.
Información adicional
Size 50 uL
Gene Name FBXW8
Gene Alias FBW6|FBW8|FBX29|FBXO29|FBXW6|MGC33534
Gene Description F-box and WD repeat domain containing 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXW8 (NP_699179, 499 a.a. ~ 598 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26259

Enviar uma mensagem


FBXW8 polyclonal antibody (A01)

FBXW8 polyclonal antibody (A01)