PLDN monoclonal antibody (M10), clone 3D2
  • PLDN monoclonal antibody (M10), clone 3D2

PLDN monoclonal antibody (M10), clone 3D2

Ref: AB-H00026258-M10
PLDN monoclonal antibody (M10), clone 3D2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PLDN.
Información adicional
Size 100 ug
Gene Name PLDN
Gene Alias PA|PALLID
Gene Description pallidin homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLDN (AAH04819, 1 a.a. ~ 172 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26258
Clone Number 3D2
Iso type IgG1 Kappa

Enviar uma mensagem


PLDN monoclonal antibody (M10), clone 3D2

PLDN monoclonal antibody (M10), clone 3D2