PLDN monoclonal antibody (M01), clone 2H8
  • PLDN monoclonal antibody (M01), clone 2H8

PLDN monoclonal antibody (M01), clone 2H8

Ref: AB-H00026258-M01
PLDN monoclonal antibody (M01), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLDN.
Información adicional
Size 100 ug
Gene Name PLDN
Gene Alias PA|PALLID
Gene Description pallidin homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSML
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLDN (NP_036520.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26258
Clone Number 2H8
Iso type IgG2a Kappa

Enviar uma mensagem


PLDN monoclonal antibody (M01), clone 2H8

PLDN monoclonal antibody (M01), clone 2H8