PLDN purified MaxPab mouse polyclonal antibody (B01P)
  • PLDN purified MaxPab mouse polyclonal antibody (B01P)

PLDN purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026258-B01P
PLDN purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PLDN protein.
Información adicional
Size 50 ug
Gene Name PLDN
Gene Alias PA|PALLID
Gene Description pallidin homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLDN (NP_036520.1, 1 a.a. ~ 172 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26258

Enviar uma mensagem


PLDN purified MaxPab mouse polyclonal antibody (B01P)

PLDN purified MaxPab mouse polyclonal antibody (B01P)