NKX2-8 purified MaxPab mouse polyclonal antibody (B01P)
  • NKX2-8 purified MaxPab mouse polyclonal antibody (B01P)

NKX2-8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026257-B01P
NKX2-8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NKX2-8 protein.
Información adicional
Size 50 ug
Gene Name NKX2-8
Gene Alias NKX2.8|NKX2H|Nkx2-9
Gene Description NK2 homeobox 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NKX2-8 (NP_055175.2, 1 a.a. ~ 239 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26257

Enviar uma mensagem


NKX2-8 purified MaxPab mouse polyclonal antibody (B01P)

NKX2-8 purified MaxPab mouse polyclonal antibody (B01P)