FBXO2 purified MaxPab mouse polyclonal antibody (B01P)
  • FBXO2 purified MaxPab mouse polyclonal antibody (B01P)

FBXO2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026232-B01P
FBXO2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FBXO2 protein.
Información adicional
Size 50 ug
Gene Name FBXO2
Gene Alias FBG1|FBX2|Fbs1|NFB42
Gene Description F-box protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXO2 (NP_036300.2, 1 a.a. ~ 296 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26232

Enviar uma mensagem


FBXO2 purified MaxPab mouse polyclonal antibody (B01P)

FBXO2 purified MaxPab mouse polyclonal antibody (B01P)