B3GAT3 purified MaxPab mouse polyclonal antibody (B01P)
  • B3GAT3 purified MaxPab mouse polyclonal antibody (B01P)

B3GAT3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026229-B01P
B3GAT3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human B3GAT3 protein.
Información adicional
Size 50 ug
Gene Name B3GAT3
Gene Alias GLCATI|GlcAT-I
Gene Description beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPLVSGLLAASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFEEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPSRPFPVDMAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen B3GAT3 (NP_036332.2, 1 a.a. ~ 335 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26229

Enviar uma mensagem


B3GAT3 purified MaxPab mouse polyclonal antibody (B01P)

B3GAT3 purified MaxPab mouse polyclonal antibody (B01P)