BRDG1 monoclonal antibody (M01), clone 5A10
  • BRDG1 monoclonal antibody (M01), clone 5A10

BRDG1 monoclonal antibody (M01), clone 5A10

Ref: AB-H00026228-M01
BRDG1 monoclonal antibody (M01), clone 5A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BRDG1.
Información adicional
Size 100 ug
Gene Name STAP1
Gene Alias BRDG1|STAP-1
Gene Description signal transducing adaptor family member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq EATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BRDG1 (NP_036240, 186 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26228
Clone Number 5A10
Iso type IgG1 Kappa

Enviar uma mensagem


BRDG1 monoclonal antibody (M01), clone 5A10

BRDG1 monoclonal antibody (M01), clone 5A10