BRDG1 polyclonal antibody (A01)
  • BRDG1 polyclonal antibody (A01)

BRDG1 polyclonal antibody (A01)

Ref: AB-H00026228-A01
BRDG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BRDG1.
Información adicional
Size 50 uL
Gene Name STAP1
Gene Alias BRDG1|STAP-1
Gene Description signal transducing adaptor family member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq EATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BRDG1 (NP_036240, 186 a.a. ~ 293 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26228

Enviar uma mensagem


BRDG1 polyclonal antibody (A01)

BRDG1 polyclonal antibody (A01)