FBXL3 polyclonal antibody (A01)
  • FBXL3 polyclonal antibody (A01)

FBXL3 polyclonal antibody (A01)

Ref: AB-H00026224-A01
FBXL3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXL3.
Información adicional
Size 50 uL
Gene Name FBXL3
Gene Alias FBL3|FBL3A|FBXL3A
Gene Description F-box and leucine-rich repeat protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXL3 (NP_036290, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26224

Enviar uma mensagem


FBXL3 polyclonal antibody (A01)

FBXL3 polyclonal antibody (A01)