FBXL21 monoclonal antibody (M02), clone 4A1
  • FBXL21 monoclonal antibody (M02), clone 4A1

FBXL21 monoclonal antibody (M02), clone 4A1

Ref: AB-H00026223-M02
FBXL21 monoclonal antibody (M02), clone 4A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FBXL21.
Información adicional
Size 100 ug
Gene Name FBXL21
Gene Alias FBL3B|FBXL3B|FBXL3P|Fbl21|MGC120237
Gene Description F-box and leucine-rich repeat protein 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSKYLGRVWFPDVMPLW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXL21 (NP_036291, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26223
Clone Number 4A1
Iso type IgG2a Kappa

Enviar uma mensagem


FBXL21 monoclonal antibody (M02), clone 4A1

FBXL21 monoclonal antibody (M02), clone 4A1