FBXL21 polyclonal antibody (A01)
  • FBXL21 polyclonal antibody (A01)

FBXL21 polyclonal antibody (A01)

Ref: AB-H00026223-A01
FBXL21 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXL21.
Información adicional
Size 50 uL
Gene Name FBXL21
Gene Alias FBL3B|FBXL3B|FBXL3P|Fbl21|MGC120237
Gene Description F-box and leucine-rich repeat protein 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSKYLGRVWFPDVMPLW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXL21 (NP_036291, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26223

Enviar uma mensagem


FBXL21 polyclonal antibody (A01)

FBXL21 polyclonal antibody (A01)