PTPN22 monoclonal antibody (M02), clone 1A6
  • PTPN22 monoclonal antibody (M02), clone 1A6

PTPN22 monoclonal antibody (M02), clone 1A6

Ref: AB-H00026191-M02
PTPN22 monoclonal antibody (M02), clone 1A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTPN22.
Información adicional
Size 100 ug
Gene Name PTPN22
Gene Alias LYP|Lyp1|Lyp2|PEP|PTPN8
Gene Description protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq FLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTPN22 (NP_057051.2, 10 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26191
Clone Number 1A6
Iso type IgG2a Kappa

Enviar uma mensagem


PTPN22 monoclonal antibody (M02), clone 1A6

PTPN22 monoclonal antibody (M02), clone 1A6