SENP3 purified MaxPab rabbit polyclonal antibody (D01P)
  • SENP3 purified MaxPab rabbit polyclonal antibody (D01P)

SENP3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00026168-D01P
SENP3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SENP3 protein.
Información adicional
Size 100 ug
Gene Name SENP3
Gene Alias DKFZp586K0919|DKFZp762A152|SMT3IP1|SSP3
Gene Description SUMO1/sentrin/SMT3 specific peptidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MKETIQGTGSWGPEPPGPGIPPAYSSPRRERLRWPPPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASASEEEEEEEEEEDEDEEEEVAAWRLPPRWSQLGTSQRPRPSRPTHRKTCSQRRRRAMRAFRMLLYSKSTSLTFHWKLWGRHRGRRRGLAHPKNHLSPQQGGATPQVPSPCCRFDSPRGPPPPRLGLLGALMAEDGVRGSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLPNGFGGQSGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SENP3 (NP_056485.2, 1 a.a. ~ 574 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26168

Enviar uma mensagem


SENP3 purified MaxPab rabbit polyclonal antibody (D01P)

SENP3 purified MaxPab rabbit polyclonal antibody (D01P)