GTPBP5 purified MaxPab mouse polyclonal antibody (B01P)
  • GTPBP5 purified MaxPab mouse polyclonal antibody (B01P)

GTPBP5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026164-B01P
GTPBP5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GTPBP5 protein.
Información adicional
Size 50 ug
Gene Name GTPBP5
Gene Alias FLJ10741|MGC29512|ObgH1|dJ1005F21.2
Gene Description GTP binding protein 5 (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGKKLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTPBP5 (NP_056481, 1 a.a. ~ 406 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26164

Enviar uma mensagem


GTPBP5 purified MaxPab mouse polyclonal antibody (B01P)

GTPBP5 purified MaxPab mouse polyclonal antibody (B01P)