GIMAP2 monoclonal antibody (M01), clone 1E10
  • GIMAP2 monoclonal antibody (M01), clone 1E10

GIMAP2 monoclonal antibody (M01), clone 1E10

Ref: AB-H00026157-M01
GIMAP2 monoclonal antibody (M01), clone 1E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GIMAP2.
Información adicional
Size 100 ug
Gene Name GIMAP2
Gene Alias DKFZp586D0824|HIMAP2|IMAP2|MGC24275
Gene Description GTPase, IMAP family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GIMAP2 (NP_056475.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26157
Clone Number 1E10
Iso type IgG2a Kappa

Enviar uma mensagem


GIMAP2 monoclonal antibody (M01), clone 1E10

GIMAP2 monoclonal antibody (M01), clone 1E10