PHF19 purified MaxPab mouse polyclonal antibody (B01P)
  • PHF19 purified MaxPab mouse polyclonal antibody (B01P)

PHF19 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026147-B01P
PHF19 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PHF19 protein.
Información adicional
Size 50 ug
Gene Name PHF19
Gene Alias MGC131698|MGC149712|MGC149713|MGC23929|MTF2L1|PCL3
Gene Description PHD finger protein 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PHF19 (NP_001009936.1, 1 a.a. ~ 207 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26147

Enviar uma mensagem


PHF19 purified MaxPab mouse polyclonal antibody (B01P)

PHF19 purified MaxPab mouse polyclonal antibody (B01P)