Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZBTB20 monoclonal antibody (M01), clone 1F3
Abnova
ZBTB20 monoclonal antibody (M01), clone 1F3
Ref: AB-H00026137-M01
ZBTB20 monoclonal antibody (M01), clone 1F3
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZBTB20.
Información adicional
Size
100 ug
Gene Name
ZBTB20
Gene Alias
DKFZp566F123|DPZF|HOF|ODA-8S|ZNF288
Gene Description
zinc finger and BTB domain containing 20
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq
FLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRSF
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZBTB20 (NP_056457, 451 a.a. ~ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
26137
Clone Number
1F3
Iso type
IgG2a Kappa
Enviar uma mensagem
ZBTB20 monoclonal antibody (M01), clone 1F3
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*