TES polyclonal antibody (A01)
  • TES polyclonal antibody (A01)

TES polyclonal antibody (A01)

Ref: AB-H00026136-A01
TES polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TES.
Información adicional
Size 50 uL
Gene Name TES
Gene Alias DKFZp586B2022|MGC1146|TESS|TESS-2
Gene Description testis derived transcript (3 LIM domains)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TES (AAH01451, 1 a.a. ~ 421 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26136

Enviar uma mensagem


TES polyclonal antibody (A01)

TES polyclonal antibody (A01)