View larger
Mouse monoclonal antibody raised against a full length recombinant SERBP1.
AB-H00026135-M01
New product
SERBP1 monoclonal antibody (M01), clone 1D2-2E9
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | SERBP1 |
| Gene Alias | CGI-55|CHD3IP|DKFZp564M2423|FLJ90489|HABP4L|PAI-RBP1|PAIRBP1 |
| Gene Description | SERPINE1 mRNA binding protein 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SERBP1 (AAH02488, 1 a.a. ~ 402 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 26135 |
| Clone Number | 1D2-2E9 |
| Iso type | IgG1 kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant SERBP1.