TRPC4AP monoclonal antibody (M07), clone 3G4
  • TRPC4AP monoclonal antibody (M07), clone 3G4

TRPC4AP monoclonal antibody (M07), clone 3G4

Ref: AB-H00026133-M07
TRPC4AP monoclonal antibody (M07), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRPC4AP.
Información adicional
Size 100 ug
Gene Name TRPC4AP
Gene Alias C20orf188|TRRP4AP|TRUSS
Gene Description transient receptor potential cation channel, subfamily C, member 4 associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq VANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRPC4AP (NP_056453, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26133
Clone Number 3G4
Iso type IgG2a Kappa

Enviar uma mensagem


TRPC4AP monoclonal antibody (M07), clone 3G4

TRPC4AP monoclonal antibody (M07), clone 3G4