TRPC4AP purified MaxPab rabbit polyclonal antibody (D01P)
  • TRPC4AP purified MaxPab rabbit polyclonal antibody (D01P)

TRPC4AP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00026133-D01P
TRPC4AP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TRPC4AP protein.
Información adicional
Size 100 ug
Gene Name TRPC4AP
Gene Alias C20orf188|TRRP4AP|TRUSS
Gene Description transient receptor potential cation channel, subfamily C, member 4 associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAAPVAAGSGAGRGRRSAATVAAWGGWGGRPRPGNILLQLRQGQLTGRGLVRAVQFTETFLTERDKQSKWSGIPQLLLKLHTTSHLHSDFVECQNILKEISPLLSMEAMAFVTEERKLTQETTYPNTYIFDLFGGVDLLVEILMRPTISIRGQKLKISDEMSKDCLSILYNTCVCTEGVTKRLAEKNDFVIFLFTLMTSKKTFLQTATLIEDILGVKKEMIRLDEVPNLSSLVSNFDQQQLANFCRILAVTISE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRPC4AP (NP_056453.1, 1 a.a. ~ 797 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26133

Enviar uma mensagem


TRPC4AP purified MaxPab rabbit polyclonal antibody (D01P)

TRPC4AP purified MaxPab rabbit polyclonal antibody (D01P)