TRPC4AP polyclonal antibody (A01)
  • TRPC4AP polyclonal antibody (A01)

TRPC4AP polyclonal antibody (A01)

Ref: AB-H00026133-A01
TRPC4AP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRPC4AP.
Información adicional
Size 50 uL
Gene Name TRPC4AP
Gene Alias C20orf188|TRRP4AP|TRUSS
Gene Description transient receptor potential cation channel, subfamily C, member 4 associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRPC4AP (NP_056453, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26133

Enviar uma mensagem


TRPC4AP polyclonal antibody (A01)

TRPC4AP polyclonal antibody (A01)