GAPVD1 purified MaxPab mouse polyclonal antibody (B01P)
  • GAPVD1 purified MaxPab mouse polyclonal antibody (B01P)

GAPVD1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026130-B01P
GAPVD1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GAPVD1 protein.
Información adicional
Size 50 ug
Gene Name GAPVD1
Gene Alias DKFZp434C212|GAPEX5|KIAA1521|MGC138847|MGC138848|RAP6
Gene Description GTPase activating protein and VPS9 domains 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MQEDESYLLQVLRYLIEFELKESDNPRRLLRRGTCAFSILFKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQEKLFGEKGSDRFRQKVQEMVESNEAKLVALVNKFIGYLKQNTYCFPHSLRWIVSQMYKTLSCVDRLEVGEVRAMCTDLLLACFICPAVVNPEQYGIISDAPINEVARFNLMQVGRLLQQLAMTGSEEGDPRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPLSSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GAPVD1 (AAH21119.1, 1 a.a. ~ 629 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26130

Enviar uma mensagem


GAPVD1 purified MaxPab mouse polyclonal antibody (B01P)

GAPVD1 purified MaxPab mouse polyclonal antibody (B01P)