PRPF31 polyclonal antibody (A01)
  • PRPF31 polyclonal antibody (A01)

PRPF31 polyclonal antibody (A01)

Ref: AB-H00026121-A01
PRPF31 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRPF31.
Información adicional
Size 50 uL
Gene Name PRPF31
Gene Alias DKFZp566J153|NY-BR-99|PRP31|RP11
Gene Description PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRPF31 (NP_056444, 400 a.a. ~ 499 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26121

Enviar uma mensagem


PRPF31 polyclonal antibody (A01)

PRPF31 polyclonal antibody (A01)