DECR2 MaxPab rabbit polyclonal antibody (D01)
  • DECR2 MaxPab rabbit polyclonal antibody (D01)

DECR2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00026063-D01
DECR2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DECR2 protein.
Información adicional
Size 100 uL
Gene Name DECR2
Gene Alias PDCR|SDR17C1
Gene Description 2,4-dienoyl CoA reductase 2, peroxisomal
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DECR2 (NP_065715.1, 1 a.a. ~ 292 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 26063

Enviar uma mensagem


DECR2 MaxPab rabbit polyclonal antibody (D01)

DECR2 MaxPab rabbit polyclonal antibody (D01)