ZNF500 monoclonal antibody (M06), clone 2H1
  • ZNF500 monoclonal antibody (M06), clone 2H1

ZNF500 monoclonal antibody (M06), clone 2H1

Ref: AB-H00026048-M06
ZNF500 monoclonal antibody (M06), clone 2H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF500.
Información adicional
Size 100 ug
Gene Name ZNF500
Gene Alias ZKSCAN18
Gene Description zinc finger protein 500
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QRVHTGEKPYPCPECGKRFSQSSSLVIHRRTHSGERPYACTQCGKRFNNSSHFSAHRRTHTGEKPYTCPACGRGFRRGTDLHKHQRTHMGAGSLPTLQPVAPGGPGAKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF500 (NP_067678, 372 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26048
Clone Number 2H1
Iso type IgG2a Kappa

Enviar uma mensagem


ZNF500 monoclonal antibody (M06), clone 2H1

ZNF500 monoclonal antibody (M06), clone 2H1