CNTNAP2 MaxPab rabbit polyclonal antibody (D01)
  • CNTNAP2 MaxPab rabbit polyclonal antibody (D01)

CNTNAP2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00026047-D01
CNTNAP2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CNTNAP2 protein.
Información adicional
Size 100 uL
Gene Name CNTNAP2
Gene Alias AUTS15|CASPR2|CDFE|DKFZp781D1846|NRXN4
Gene Description contactin associated protein-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MQAAPRAGCGAALLLWIVSSCLCRAWTAPSTSQKCDEPLVSGLPHVAFSSSSSISGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPIIARYVRIVPLDWNGEGRIGLRIEVYGCSYWADVINFDGHVVLPYRFRNKKMKTLKDVIALNFKTSESEGVILHGEGQQGDYITLELKKAKLVLSLNLGSNQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CNTNAP2 (NP_054860.1, 1 a.a. ~ 1331 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 26047

Enviar uma mensagem


CNTNAP2 MaxPab rabbit polyclonal antibody (D01)

CNTNAP2 MaxPab rabbit polyclonal antibody (D01)