GORASP2 polyclonal antibody (A01)
  • GORASP2 polyclonal antibody (A01)

GORASP2 polyclonal antibody (A01)

Ref: AB-H00026003-A01
GORASP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GORASP2.
Información adicional
Size 50 uL
Gene Name GORASP2
Gene Alias DKFZp434D156|FLJ13139|GOLPH6|GRASP55|GRS2|p59
Gene Description golgi reassembly stacking protein 2, 55kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELRETSVTPSNLWGGQGLLGVSI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GORASP2 (NP_056345, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26003

Enviar uma mensagem


GORASP2 polyclonal antibody (A01)

GORASP2 polyclonal antibody (A01)