SNED1 purified MaxPab mouse polyclonal antibody (B01P)
  • SNED1 purified MaxPab mouse polyclonal antibody (B01P)

SNED1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025992-B01P
SNED1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SNED1 protein.
Información adicional
Size 50 ug
Gene Name SNED1
Gene Alias DKFZp586B2420|FLJ00133|SST3|Snep
Gene Description sushi, nidogen and EGF-like domains 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MHGILGACGRLRLEPATPLTPLLCAERDECRAHPCRNGGSCRNLPGAYVCRCPAGFVGVHCETEVDACDSSPCQHGGRCESGGGAYLCVCPESFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGEDCAKELFPPTALKMERVEESGVSISWNPPNGPAARQMLDGYAVTYVSSDGSYRRTDFVDRTRSSHQLQALAAGRAYNISVFSVKRNSNNKNDISRPAVLLARTRPRPVEGFEVTNVTAST
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNED1 (AAH27939, 1 a.a. ~ 600 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25992

Enviar uma mensagem


SNED1 purified MaxPab mouse polyclonal antibody (B01P)

SNED1 purified MaxPab mouse polyclonal antibody (B01P)