MMACHC purified MaxPab rabbit polyclonal antibody (D01P)
  • MMACHC purified MaxPab rabbit polyclonal antibody (D01P)

MMACHC purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00025974-D01P
MMACHC purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MMACHC protein.
Información adicional
Size 100 ug
Gene Name MMACHC
Gene Alias DKFZp564I122|FLJ25671|RP11-291L19.3
Gene Description methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMACHC (AAH06122.3, 1 a.a. ~ 225 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25974

Enviar uma mensagem


MMACHC purified MaxPab rabbit polyclonal antibody (D01P)

MMACHC purified MaxPab rabbit polyclonal antibody (D01P)