SH2B monoclonal antibody (M01), clone 2B9
  • SH2B monoclonal antibody (M01), clone 2B9

SH2B monoclonal antibody (M01), clone 2B9

Ref: AB-H00025970-M01
SH2B monoclonal antibody (M01), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SH2B.
Información adicional
Size 100 ug
Gene Name SH2B1
Gene Alias DKFZp547G1110|FLJ30542|KIAA1299|SH2-B|SH2B
Gene Description SH2B adaptor protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq GKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH2B (AAH10704, 327 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25970
Clone Number 2B9
Iso type IgG1 Kappa

Enviar uma mensagem


SH2B monoclonal antibody (M01), clone 2B9

SH2B monoclonal antibody (M01), clone 2B9