C2CD2 purified MaxPab rabbit polyclonal antibody (D01P)
  • C2CD2 purified MaxPab rabbit polyclonal antibody (D01P)

C2CD2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00025966-D01P
C2CD2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C2CD2 protein.
Información adicional
Size 100 ug
Gene Name C2CD2
Gene Alias C21orf25|C21orf258|DKFZp586F0422|DKFZp686O198|MGC71445|TMEM24L
Gene Description C2 calcium-dependent domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRLSPFHLQLEFHMKEKREDLQISWSFISVPEMAVNIQPKALGEDQVAETSAMSDVLKDILKHLAGSASPSVVLITKPTTVKEAQNLQCAASTAQESCPPKPPRAHELKLLVRNIHVLLLSEPGASGHINAVCVVQLNDPVQRFSSTLTKNTPDLMWEEEFTFELNAKSKELHLQISEAGRSSEGLLATATVPLDLFKKQPSGPQSFTLTSGSACGSSVLGSVTAEFSYMEPGELKSWPIPPPVPAAKIEKDRTV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C2CD2 (AAH62323.1, 1 a.a. ~ 388 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25966

Enviar uma mensagem


C2CD2 purified MaxPab rabbit polyclonal antibody (D01P)

C2CD2 purified MaxPab rabbit polyclonal antibody (D01P)