ZNF385 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF385 purified MaxPab mouse polyclonal antibody (B01P)

ZNF385 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025946-B01P
ZNF385 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF385 protein.
Información adicional
Size 50 ug
Gene Name ZNF385A
Gene Alias DKFZp586G1122|HZF|RZF|ZFP385|ZNF385
Gene Description zinc finger protein 385A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQPPLDLKQILPFPLEPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNSQSQAEAHYKGNRHARRVKGIEAAKTRGREPGVREPGDPAPPGSTPTNGDGVAPRPVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKEEEEKAKRLLYCALCKVAVNSLSQLEAHNKGTKHKTILEARSGLGPIKAYPRLGPPTPGEPEAPAQDRTFHCEICNVKVNSEVQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF385 (NP_056296.1, 1 a.a. ~ 366 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25946

Enviar uma mensagem


ZNF385 purified MaxPab mouse polyclonal antibody (B01P)

ZNF385 purified MaxPab mouse polyclonal antibody (B01P)