PVRL3 monoclonal antibody (M01), clone 1D1
  • PVRL3 monoclonal antibody (M01), clone 1D1

PVRL3 monoclonal antibody (M01), clone 1D1

Ref: AB-H00025945-M01
PVRL3 monoclonal antibody (M01), clone 1D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PVRL3.
Información adicional
Size 100 ug
Gene Name PVRL3
Gene Alias CD113|CDw113|DKFZp566B0846|FLJ90624|PPR3|PRR3|PVRR3|nectin-3
Gene Description poliovirus receptor-related 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq PIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PVRL3 (NP_056295, 59 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25945
Clone Number 1D1
Iso type IgG2a Kappa

Enviar uma mensagem


PVRL3 monoclonal antibody (M01), clone 1D1

PVRL3 monoclonal antibody (M01), clone 1D1