SIN3A monoclonal antibody (M01), clone 1B7
  • SIN3A monoclonal antibody (M01), clone 1B7

SIN3A monoclonal antibody (M01), clone 1B7

Ref: AB-H00025942-M01
SIN3A monoclonal antibody (M01), clone 1B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIN3A.
Información adicional
Size 100 ug
Gene Name SIN3A
Gene Alias DKFZp434K2235|FLJ90319|KIAA0700
Gene Description SIN3 homolog A, transcription regulator (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIN3A (NP_056292.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25942
Clone Number 1B7
Iso type IgG1 Kappa

Enviar uma mensagem


SIN3A monoclonal antibody (M01), clone 1B7

SIN3A monoclonal antibody (M01), clone 1B7