SAMHD1 MaxPab rabbit polyclonal antibody (D01)
  • SAMHD1 MaxPab rabbit polyclonal antibody (D01)

SAMHD1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00025939-D01
SAMHD1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SAMHD1 protein.
Información adicional
Size 100 uL
Gene Name SAMHD1
Gene Alias DCIP|HDDC1|MOP-5|SBBI88
Gene Description SAM domain and HD domain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVME
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SAMHD1 (NP_056289.2, 1 a.a. ~ 626 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 25939

Enviar uma mensagem


SAMHD1 MaxPab rabbit polyclonal antibody (D01)

SAMHD1 MaxPab rabbit polyclonal antibody (D01)