PTPN23 purified MaxPab mouse polyclonal antibody (B01P)
  • PTPN23 purified MaxPab mouse polyclonal antibody (B01P)

PTPN23 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025930-B01P
PTPN23 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PTPN23 protein.
Información adicional
Size 50 ug
Gene Name PTPN23
Gene Alias DKFZp564F0923|HD-PTP|HDPTP|KIAA1471|PTP-TD14
Gene Description protein tyrosine phosphatase, non-receptor type 23
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGPQAAPLTIRGPSSAGQSTPSPHLVPSPAPSPGPGPVPPRPPAAEPPPCLRRGAAAADLLSSSPESQHGGTQSPGGGQPLLQPTKVDAAEGRRPQALRLIERDPYEHPERLRQLQQELEAFRGQLGDVGALDTVWRELQDAQEHDARGRSIAIARCYSLKNRHQDVMPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLVATQAPLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTPN23 (AAH04881, 1 a.a. ~ 577 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25930

Enviar uma mensagem


PTPN23 purified MaxPab mouse polyclonal antibody (B01P)

PTPN23 purified MaxPab mouse polyclonal antibody (B01P)