POT1 polyclonal antibody (A01)
  • POT1 polyclonal antibody (A01)

POT1 polyclonal antibody (A01)

Ref: AB-H00025913-A01
POT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POT1.
Información adicional
Size 50 uL
Gene Name POT1
Gene Alias DKFZp586D211|hPot1
Gene Description POT1 protection of telomeres 1 homolog (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POT1 (NP_056265, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25913

Enviar uma mensagem


POT1 polyclonal antibody (A01)

POT1 polyclonal antibody (A01)