CNOT10 purified MaxPab mouse polyclonal antibody (B01P)
  • CNOT10 purified MaxPab mouse polyclonal antibody (B01P)

CNOT10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025904-B01P
CNOT10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CNOT10 protein.
Información adicional
Size 50 ug
Gene Name CNOT10
Gene Alias DKFZp434K115|FLJ12890|FLJ13165
Gene Description CCR4-NOT transcription complex, subunit 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAADKPADQGAEKHEGTGQSSGITDQEKELSTNAFQAFTSGNYDACLQHLACLQDINKDDYKIILNTAVAEFFKSNQTTTDNLRQTLNQLKNQVHSAVEEMDGLDDVENSMLYYNQAVILYHLRQYTEAISVGEKLYQFIEPFEEKFAQAVCFLLVDLYILTYQAEKALHLLAVLEKMISQGNNNKNGKNETGNNNNKDGSNHKAESGALIEAAKSKIHQYKVRAYIQMKSLKACKREIKSVMNTAGNSAPSLFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CNOT10 (NP_056257.1, 1 a.a. ~ 744 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25904

Enviar uma mensagem


CNOT10 purified MaxPab mouse polyclonal antibody (B01P)

CNOT10 purified MaxPab mouse polyclonal antibody (B01P)