MTHFD1L polyclonal antibody (A01)
  • MTHFD1L polyclonal antibody (A01)

MTHFD1L polyclonal antibody (A01)

Ref: AB-H00025902-A01
MTHFD1L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MTHFD1L.
Información adicional
Size 50 uL
Gene Name MTHFD1L
Gene Alias DKFZp586G1517|FLJ21145|FTHFSDC1|MTC1THFS|dJ292B18.2
Gene Description methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTHFD1L (NP_056255, 801 a.a. ~ 899 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25902

Enviar uma mensagem


MTHFD1L polyclonal antibody (A01)

MTHFD1L polyclonal antibody (A01)