HOM-TES-103 MaxPab mouse polyclonal antibody (B01P)
  • HOM-TES-103 MaxPab mouse polyclonal antibody (B01P)

HOM-TES-103 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025900-B01P
HOM-TES-103 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HOM-TES-103 protein.
Información adicional
Size 50 ug
Gene Name IFFO1
Gene Alias DKFZp586I2223|FLJ20703|HOM-TES-103|IFFO|MGC117359
Gene Description intermediate filament family orphan 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HOM-TES-103 (NP_542769.2, 1 a.a. ~ 200 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25900

Enviar uma mensagem


HOM-TES-103 MaxPab mouse polyclonal antibody (B01P)

HOM-TES-103 MaxPab mouse polyclonal antibody (B01P)